Anti-UCP2 (Middle Region)

Anti-UCP2 (Middle Region)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32924 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial uncoupling proteins (UCP)... mehr
Produktinformationen "Anti-UCP2 (Middle Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'. Protein function: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. [The UniProt Consortium]
Schlagworte: Anti-UCP2, Anti-UCPH, Anti-UCP 2, Anti-SLC25A8, Anti-Solute carrier family 25 member 8, Anti-Mitochondrial uncoupling protein 2, UCP2 Antibody (Middle Region)
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32924

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids 134-170 (AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE) were used as the immunogen for the UCP2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-UCP2 (Middle Region)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen