Anti-TTPA (Tocopherol (alpha) transfer Protein, ATTP, AVED, TTP1, alphaTTP)

Anti-TTPA (Tocopherol (alpha) transfer Protein, ATTP, AVED, TTP1, alphaTTP)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
253118.200 200 µl - -

3 - 19 Werktage*

866,00 €
 
Mouse monoclonal antibody raised against a partial recombinant TTPA.||Applications: |Suitable for... mehr
Produktinformationen "Anti-TTPA (Tocopherol (alpha) transfer Protein, ATTP, AVED, TTP1, alphaTTP)"
Mouse monoclonal antibody raised against a partial recombinant TTPA. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 253118

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 7B5
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: TTPA (NP_000361.1, 179aa-278aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Ascites

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TTPA (Tocopherol (alpha) transfer Protein, ATTP, AVED, TTP1, alphaTTP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen