Anti-Transferrin

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31874 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transferrins are iron-binding blood plasma... mehr
Produktinformationen "Anti-Transferrin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. [The UniProt Consortium]
Schlagworte: Anti-TF, Anti-PRO1400, Anti-Transferrin, Anti-Siderophilin, Anti-Serotransferrin, Anti-Beta-1 metal-binding globulin, Transferrin Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31874

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin were used as the immunogen for the Transferrin antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Transferrin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen