Anti-TNF alpha

Anti-TNF alpha
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32668 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TNFa (Tumor Necrosis Factor alpha) gene... mehr
Produktinformationen "Anti-TNF alpha"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. TNFa (Tumor Necrosis Factor alpha) gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. And this cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Moreover, this cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. Protein function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (PubMed:25586176). [The UniProt Consortium]
Schlagworte: Anti-Tnf, Anti-Tnfa, TNF alpha Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32668

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse
Immunogen: Amino acids 202-235 (FQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL) from the mouse protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TNF alpha"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen