Anti-TGF beta 2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG42581.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Transforming growth factor beta-2 proprotein: Precursor of the... mehr
Produktinformationen "Anti-TGF beta 2"
Protein function: Transforming growth factor beta-2 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively. [The UniProt Consortium]
Schlagworte: Anti-TGFB2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG42581

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to a sequence of Human TGF beta 2. (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK)
MW: 48 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TGF beta 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen