Anti-TFPI2

Anti-TFPI2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32729 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tissue factor pathway inhibitor 2, also... mehr
Produktinformationen "Anti-TFPI2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney. Protein function: May play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin. [The UniProt Consortium]
Schlagworte: Anti-PP5, Anti-TFPI2, Anti-TFPI-2, Anti-Placental protein 5, Anti-Tissue factor pathway inhibitor 2, TFPI2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32729

Eigenschaften

Anwendung: WB, IHC (paraffin), FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TFPI2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen