Anti-TFIIH p52

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59647.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Component of the general transcription and DNA repair factor IIH (TFIIH) core... mehr
Produktinformationen "Anti-TFIIH p52"
Protein function: Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre- initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. [The UniProt Consortium]
Schlagworte: Anti-GTF2H4, Anti-BTF2 p52, Anti-General transcription factor IIH subunit 4, Anti-Basic transcription factor 2 52 kDa subunit, Anti-General transcription factor IIH polypeptide 4, Anti-TFIIH basal transcription factor complex p52 subunit
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59647

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, bovine, dog, goat, guinea pig, rabbit, zebrafish)
Immunogen: Synthetic peptide around the C-terminal region of Human TFIIH p52. (within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS)
MW: 52 kD
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TFIIH p52"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen