Anti-TCP1 alpha, clone 2E7-

Anti-TCP1 alpha, clone 2E7-
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4522 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit alpha is a... mehr
Produktinformationen "Anti-TCP1 alpha, clone 2E7-"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found. Protein function: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444). The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444). As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). The TRiC complex plays a role in the folding of actin and tubulin (Probable). [The UniProt Consortium]
Schlagworte: Anti-CCT1, Anti-TCP1, Anti-CCT-alpha, Anti-TCP-1-alpha, Anti-T-complex protein 1 subunit alpha, TCP1 alpha Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4522

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Monoclonal
Klon: 2E7-
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Amino acids KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TCP1 alpha, clone 2E7-"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen