Anti-Synapsin 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59113.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Neuronal phosphoprotein that coats synaptic vesicles, binds to the... mehr
Produktinformationen "Anti-Synapsin 1"
Protein function: Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. The complex formed with NOS1 and CAPON proteins is necessary for specific nitric-oxid functions at a presynaptic level. [The UniProt Consortium]
Schlagworte: Anti-SYN1, Anti-Synapsin-1, Anti-Synapsin I, Anti-Brain protein 4.1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59113

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine, dog, hamster, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 662-705 of Human Synapsin 1. (KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD)
MW: 74 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Synapsin 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen