Anti-SYK (Tyrosine-protein Kinase SYK, Spleen Tyrosine Kinase, DKFZp313N1010, FLJ25043, FLJ37489)

Syk is a cytoplasmic 72kD non-receptor tyrosine kinase that is widely expressed in hematopoietic cells. The Syk kinase associates with a number of proteins including c-Src, Lck, Lyn, Fyn, Vav1, STAT3, SHP1, Grb2, and LAT to couple immunoreceptors to downstream signaling events mediating cellular proliferation, differentiation, and phagocytosis. Syk is modified by phosphorylation on multiple tyrosine sites. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.