Anti-Stathmin 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58134.50 50 µg - -

6 - 14 Werktage*

559,00 €
 
Protein function: Involved in the regulation of the microtubule (MT) filament system by... mehr
Produktinformationen "Anti-Stathmin 1"
Protein function: Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser- 16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear. [The UniProt Consortium]
Schlagworte: Anti-Op18, Anti-pp19, Anti-pp17, Anti-STMN1, Anti-Prosolin, Anti-Stathmin, Anti-C1orf215, Anti-Metablastin, Anti-Protein Pr22, Anti-Oncoprotein 18, Anti-Phosphoprotein p19, Anti-Leukemia-associated phosphoprotein p18
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58134

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide of Human Stathmin 1. (ASSDIQVKELEKRASGQAFELILSPRSKESVPE)
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Stathmin 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen