Anti-STAT2

Anti-STAT2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4293 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Signal transducer and activator of... mehr
Produktinformationen "Anti-STAT2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
Schlagworte: Anti-p113, Anti-STAT2, Anti-Signal transducer and activator of transcription 2, STAT2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4293

Eigenschaften

Anwendung: WB, IF, FC, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-STAT2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen