Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
NSJ-R31925 | 100 µg | - | - |
3 - 10 Werktage* |
755,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SPARC, secreted protein acidic and rich in... mehr
Produktinformationen "Anti-SPARC"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of ~40 kDa. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV). Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found. Protein function: Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites, an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. [The UniProt Consortium]
Schlagworte: | Anti-ON, Anti-BM-40, Anti-SPARC, Anti-Osteonectin, Anti-Basement-membrane protein 40, Anti-Secreted protein acidic and rich in cysteine, SPARC Antibody |
Hersteller: | NSJ Bioreagents |
Hersteller-Nr: | R31925 |
Eigenschaften
Anwendung: | WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
Immunogen: | Amino acids RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI of human SPARC were used as the immunogen for the SPARC antibody. |
Format: | Purified |
Datenbank Information
KEGG ID : | K24262 | Passende Produkte |
UniProt ID : | P09486 | Passende Produkte |
Gene ID | GeneID 6678 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | -20°C (International: -20°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SPARC"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen