Anti-SMYD3

Anti-SMYD3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32321 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SET and MYND domain-containing protein 3... mehr
Produktinformationen "Anti-SMYD3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Histone methyltransferase. Specifically methylates 'Lys- 4' and 'Lys-5' of histone H3, inducing di- and tri-methylation, but not monomethylation. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences. [The UniProt Consortium]
Schlagworte: Anti-SMYD3, Anti-ZMYND1, EC=2.1.1.43, Anti-Histone-lysine N-methyltransferase SMYD3, Anti-SET and MYND domain-containing protein 3, Anti-Zinc finger MYND domain-containing protein 1, SMYD3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32321

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS of human SMYD3 were used as the immunogen for the SMYD3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SMYD3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen