Anti-SMC3

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32356 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Structural maintenance of chromosomes 3... mehr
Produktinformationen "Anti-SMC3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Structural maintenance of chromosomes 3 belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. Protein function: Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. [The UniProt Consortium]
Schlagworte: Anti-BAM, Anti-SMC3, Anti-hCAP, Anti-SMC-3, Anti-Bamacan, Anti-SMC protein 3, Anti-Chromosome-associated polypeptide, Anti-Chondroitin sulfate proteoglycan 6, Anti-Structural maintenance of chromosomes protein 3, SMC3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32356

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH of human SMC3 were used as the immunogen for the SMC3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SMC3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen