Anti-SLC34A2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4878 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium-dependent phosphate transport... mehr
Produktinformationen "Anti-SLC34A2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene. Protein function: Involved in actively transporting phosphate into cells via Na(+) cotransport. [The UniProt Consortium]
Schlagworte: Anti-NaPi3b, Anti-NaPi-2b, Anti-SLC34A2, Anti-Na(+)/Pi cotransporter 2B, Anti-Solute carrier family 34 member 2, Anti-Sodium/phosphate cotransporter 2B, Anti-Sodium-phosphate transport protein 2B, Anti-Na(+)-dependent phosphate cotransporter 2B, SLC34A2 A
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4878

Eigenschaften

Anwendung: WB, IHC (paraffin), IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SLC34A2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen