| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| ARG59640.50 | 50 µl | - | - |
10 - 15 Werktage* |
584,00 €
|
| Schlagworte: | Anti-CAC, Anti-SLC25A20, Anti-Solute carrier family 25 member 20, Anti-Carnitine/acylcarnitine translocase, Anti-Mitochondrial carnitine/acylcarnitine carrier protein |
| Hersteller: | Arigo Biolaboratories |
| Hersteller-Nr: | ARG59640 |
Eigenschaften
| Anwendung: | WB |
| Antikörper-Typ: | Polyclonal |
| Konjugat: | No |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit, sheep, zebrafish) |
| Immunogen: | Synthetic peptide around the C-terminal region of Human SLC25A20. (within the following region: GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL) |
| MW: | 33 kD |
| Format: | Affinity Purified |
Datenbank Information
| KEGG ID : | K15109 | Passende Produkte |
| UniProt ID : | O43772 | Passende Produkte |
| Gene ID : | GeneID 788 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | -20°C |
| Versand: | +4°C (International: °C) |
