Anti-SLC13A5

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Preis
ARG40274.50	50 µl		-	-	6 - 14 Werktage*		520,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into... mehr

Menü schließen

Produktinformationen "Anti-SLC13A5"

Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic, it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. [The UniProt Consortium]

Schlagworte:	Anti-NACT, Anti-NaCT, Anti-SLC13A5, Anti-Na(+)/citrate cotransporter, Anti-Solute carrier family 13 member 5, Anti-Sodium-coupled citrate transporter, Anti-Sodium-dependent citrate transporter
Hersteller:	Arigo Biolaboratories
Hersteller-Nr:	ARG40274

Eigenschaften

Anwendung:	WB
Antikörper-Typ:	Polyclonal
Konjugat:	No
Wirt:	Rabbit
Spezies-Reaktivität:	human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the middle region of Human SLC13A5. (within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF)
MW:	63 kD
Format:	Affinity Purified

Datenbank Information

KEGG ID :	K14445 \| Passende Produkte
UniProt ID :	Q86YT5 \| Passende Produkte
Gene ID	GeneID 284111 \| Passende Produkte

Handhabung & Sicherheit

Lagerung:	-20°C
Versand:	+4°C (International: °C)

Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!

Hier folgen Informationen zur Produktreferenz. mehr

Menü schließen

View product citations for antibody ARG40274 on CiteAb

Hier kriegen Sie ein Zertifikat

Zurück

Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.

Bewertungen lesen, schreiben und diskutieren... mehr

Menü schließen

Kundenbewertungen für "Anti-SLC13A5"

Bewertung schreiben

Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.