Anti-SCN4B

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4934 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium channel beta-subunit 4, also known... mehr
Produktinformationen "Anti-SCN4B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sodium channel beta-subunit 4, also known as SCN4B or Na?4, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene. Protein function: Modulates channel gating kinetics. Causes negative shifts in the voltage dependence of activation of certain alpha sodium channels, but does not affect the voltage dependence of inactivation. Modulates the susceptibility of the sodium channel to inhibition by toxic peptides from spider, scorpion, wasp and sea anemone venom. [The UniProt Consortium]
Schlagworte: Anti-SCN4B, Anti-Sodium channel subunit beta-4, SCN4B Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4934

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SCN4B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen