Anti-SCN11A

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG42591.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: This protein mediates the voltage-dependent sodium ion permeability of... mehr
Produktinformationen "Anti-SCN11A"
Protein function: This protein mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which sodium ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-resistant sodium channel isoform. Also involved, with the contribution of the receptor tyrosine kinase NTRK2, in rapid BDNF-evoked neuronal depolarization. [The UniProt Consortium]
Schlagworte: Anti-PN5, Anti-hNaN, Anti-SCN12A, Anti-SCN11A, Anti-Sensory neuron sodium channel 2, Anti-Peripheral nerve sodium channel 5, Anti-Sodium channel protein type XI subunit alpha, Anti-Sodium channel protein type 11 subunit alpha
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG42591

Eigenschaften

Anwendung: FC, IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human SCN11A. (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK)
MW: 205 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SCN11A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen