Anti-SCML1 (Sex Comb on Midleg-like Protein 1)

Anti-SCML1 (Sex Comb on Midleg-like Protein 1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133021.100 100 µg - -

9 - 20 Werktage*

850,00 €
 
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which... mehr
Produktinformationen "Anti-SCML1 (Sex Comb on Midleg-like Protein 1)"
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation. Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: KNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHN*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133021

Eigenschaften

Anwendung: ELISA, IF, IHC, WB
Antikörper-Typ: Monoclonal
Klon: 4G3
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SCML1 (Sex Comb on Midleg-like Protein 1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen