Anti-RIP3

Anti-RIP3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41273.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: Essential for necroptosis, a programmed cell death process in response to... mehr
Produktinformationen "Anti-RIP3"
Protein function: Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production. [The UniProt Consortium]
Schlagworte: Anti-RIP3, Anti-RIP-3, Anti-RIPK3, EC=2.7.11.1, Anti-RIP-like protein kinase 3, Anti-Receptor-interacting protein 3, Anti-Receptor-interacting serine/threonine-protein kinase 3
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41273

Eigenschaften

Anwendung: IP, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, horse, swine)
Immunogen: Synthetic peptide around the N-terminal region of Human RIP3. (within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG)
MW: 57 kD
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RIP3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen