Anti-RhoB

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG42694.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not... mehr
Produktinformationen "Anti-RhoB"
Protein function: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells. [The UniProt Consortium]
Schlagworte: Anti-h6, Anti-ARH6, Anti-RHOB, Anti-Rho cDNA clone 6, Anti-Rho-related GTP-binding protein RhoB
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG42694

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, monkey
Immunogen: Synthetic peptide corresponding to a sequence of Human RhoB. (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE)
MW: 22 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RhoB"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen