Anti-RGS16

Anti-RGS16
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41305.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Regulates G protein-coupled receptor signaling cascades. Inhibits signal... mehr
Produktinformationen "Anti-RGS16"
Protein function: Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11602604, PubMed:18434541). Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals. [The UniProt Consortium]
Schlagworte: Anti-RGSR, Anti-RGS16, Anti-RGS-r, Anti-hRGS-r, Anti-A28-RGS14P, Anti-Retinal-specific RGS, Anti-Regulator of G-protein signaling 16, Anti-Retinally abundant regulator of G-protein signaling
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41305

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: human, mouse, rat, cow, dog, horse, swine)
Immunogen: Synthetic peptide around the C-terminal region of Human RGS16. (within the following region: DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT)
MW: 23 kD
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RGS16"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen