Anti-Recoverin

Anti-Recoverin
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41303.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Acts as a calcium sensor and regulates phototransduction of cone and rod... mehr
Produktinformationen "Anti-Recoverin"
Protein function: Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light. [The UniProt Consortium]
Schlagworte: Anti-RCV1, Anti-RCVRN, Anti-Recoverin, Anti-Protein CAR, Anti-Cancer-associated retinopathy protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41303

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human Recoverin. (within the following region: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQS)
MW: 23 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Recoverin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen