Anti-RBMS1

Anti-RBMS1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41691.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Single-stranded DNA binding protein that interacts with the region upstream of... mehr
Produktinformationen "Anti-RBMS1"
Protein function: Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication. [The UniProt Consortium]
Schlagworte: Anti-RBMS1, Anti-C2orf12, Anti-Single-stranded DNA-binding protein MSSP-1, Anti-Suppressor of CDC2 with RNA-binding motif 2, Anti-RNA-binding motif, single-stranded-interacting protein 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41691

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: human, mouse, rat, cow, dog, goat, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the C-terminal region of Human RBMS1. (within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ)
MW: 45 kD
Format: Purified

Datenbank Information

UniProt ID : P29558 | Passende Produkte
Gene ID : GeneID 5937 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RBMS1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen