Anti-RAB1A

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG42601.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking,... mehr
Produktinformationen "Anti-RAB1A"
Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport. [The UniProt Consortium]
Schlagworte: Anti-RAB1, Anti-RAB1A, Anti-YPT1-related protein, Anti-Ras-related protein Rab-1A
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG42601

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: cow, rat, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the center region of Human RAB1A. (within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC)
MW: 23 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RAB1A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen