Anti-RAB11A

Anti-RAB11A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32159 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-11A is a protein... mehr
Produktinformationen "Anti-RAB11A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.
Schlagworte: Anti-YL8, Anti-RAB11, Anti-Rab-11, Anti-RAB11A, Anti-Ras-related protein Rab-11A, RAB11A Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32159

Eigenschaften

Anwendung: WB, IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ of human RAB11A were used as the immunogen for the RAB11 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RAB11A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen