Anti-PUS1

Anti-PUS1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40151.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Converts specific uridines to PSI in a number of tRNA substrates. Acts on... mehr
Produktinformationen "Anti-PUS1"
Protein function: Converts specific uridines to PSI in a number of tRNA substrates. Acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA (PubMed:10094309). Involved in regulation of nuclear receptor activity possibly through pseudouridylation of SRA1 RNA (PubMed:15327771). Isoforms 3 and 4 do not form pseudouridine when expressed in vitro (PubMed:11085940). [The UniProt Consortium]
Schlagworte: Anti-Pus1, Anti-MNCb-0873, EC=5.4.99.12, Anti-tRNA-uridine isomerase I, Anti-tRNA pseudouridine synthase A, Anti-tRNA pseudouridylate synthase I, Anti-tRNA pseudouridine(38-40) synthase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40151

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse
Immunogen: Synthetic peptide corresponding to a region of Mouse PUS1. (within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL)
MW: 48 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PUS1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen