Anti-PTP4A2

Anti-PTP4A2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32207 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein tyrosine phosphatase type IVA 2 is... mehr
Produktinformationen "Anti-PTP4A2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. Protein function: Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. [The UniProt Consortium]
Schlagworte: Anti-OV-1, Anti-PRL2, Anti-PRL-2, Anti-BM-008, Anti-PTP4A2, Anti-HU-PP-1, Anti-PTP(CAAXII), EC=3.1.3.48, Anti-Protein-tyrosine phosphatase 4a2, Anti-Protein tyrosine phosphatase type IVA 2, Anti-Protein-tyrosine phosphatase of regenerating liver 2, PTP4A2
Hersteller-Nr: R32207

Eigenschaften

Anwendung: WB, IHC (paraffin), FC
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PTP4A2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen