Anti-Prothrombin

Anti-Prothrombin
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58614.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin... mehr
Produktinformationen "Anti-Prothrombin"
Protein function: Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing. [The UniProt Consortium]
Schlagworte: Anti-F2, EC=3.4.21.5
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58614

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: rat (Erwartet: human, mouse, bovine, dog, guinea pig, horse, swine, rabbit, sheep)
Immunogen: Synthetic peptide corresponding to a region of Rat Prothrombin. (within the following sequence: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR)
MW: 70 kD
Format: Affinity Purified

Datenbank Information

UniProt ID : P18292 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Prothrombin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen