Anti-Properdin

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40846.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: A positive regulator of the alternate pathway of complement. It binds to and... mehr
Produktinformationen "Anti-Properdin"
Protein function: A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. [The UniProt Consortium]
Schlagworte: Anti-PFC, Anti-CFP, Anti-Properdin, Anti-Complement factor P
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40846

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human Properdin. (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR)
MW: 51 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Properdin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen