Anti-PREB

Anti-PREB
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59245.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Guanine nucleotide exchange factor that specifically activates the small GTPase... mehr
Produktinformationen "Anti-PREB"
Protein function: Guanine nucleotide exchange factor that specifically activates the small GTPase SAR1B. Mediates the recruitement of SAR1B and other COPII coat components to endoplasmic reticulum membranes and is therefore required for the formation of COPII transport vesicles from the ER. [The UniProt Consortium]
Schlagworte: Anti-Preb, Anti-Sec12, Anti-Prolactin regulatory element-binding protein, Anti-Mammalian guanine nucleotide exchange factor mSec12
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59245

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse (Erwartet: human, rat, bovine, dog, guinea pig, horse, swine, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Mouse PREB. (within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL)
MW: 45 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PREB"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen