Anti-PIAS4

Anti-PIAS4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59326.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase,... mehr
Produktinformationen "Anti-PIAS4"
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. [The UniProt Consortium]
Schlagworte: Anti-PIAS4, Anti-PIASy, Anti-PIASG, Anti-PIAS-gamma, Anti-E3 SUMO-protein ligase PIAS4, Anti-RING-type E3 ubiquitin transferase PIAS4, Anti-Protein inhibitor of activated STAT protein 4, Anti-Protein inhibitor of activated STAT protein gamma
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59326

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine, dog, horse, monkey)
Immunogen: Synthetic peptide corresponding to aa. 130-174 of Human PIAS4. (EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE)
MW: 57 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PIAS4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen