Anti-PIAS3

Anti-PIAS3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59267.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase,... mehr
Produktinformationen "Anti-PIAS3"
Protein function: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2 which promotes its interaction with SIRT1 (PubMed:25406032). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus (PubMed:24651376). [The UniProt Consortium]
Schlagworte: Anti-PIAS3, EC=2.3.2.-, Anti-E3 SUMO-protein ligase PIAS3, Anti-E3 SUMO-protein transferase PIAS3, Anti-Protein inhibitor of activated STAT protein 3
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59267

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human PIAS3. (QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF)
MW: 68 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PIAS3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen