Anti-PEPD

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40851.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal... mehr
Produktinformationen "Anti-PEPD"
Protein function: Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen. [The UniProt Consortium]
Schlagworte: Anti-PRD, Anti-PEPD, Anti-Prolidase, EC=3.4.13.9, Anti-Peptidase D, Anti-Imidodipeptidase, Anti-X-Pro dipeptidase, Anti-Proline dipeptidase, Anti-Xaa-Pro dipeptidase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40851

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: human, mouse, rat, cow, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the middle region of Human PEPD (within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV)
MW: 54 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PEPD"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen