Anti-PAX2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32185 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The PAX2 gene encodes Paired box gene 2,... mehr
Produktinformationen "Anti-PAX2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The PAX2 gene encodes Paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. Protein function: Transcription factor that may have a role in kidney cell differentiation (PubMed:24676634). Has a critical role in the development of the urogenital tract, the eyes, and the CNS. [The UniProt Consortium]
Schlagworte: Anti-PAX2, Anti-Paired box protein Pax-2, PAX2 Antibody
Hersteller-Nr: R32185

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH of human PAX2 were used as the immunogen for the PAX2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PAX2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen