Anti-OVOL2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41264.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Zinc-finger transcription repressor factor (PubMed:19700410). Plays a critical... mehr
Produktinformationen "Anti-OVOL2"
Protein function: Zinc-finger transcription repressor factor (PubMed:19700410). Plays a critical role in maintaining the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition (EMT) mainly through the repression of ZEB1, an EMT inducer. Positively regulates neuronal differentiation. Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1 (PubMed:19700410). Important for the correct development of primordial germ cells in embryos. [The UniProt Consortium]
Schlagworte: Anti-OVOL2, Anti-hOvo2, Anti-ZNF339, Anti-Zinc finger protein 339, Anti-Transcription factor Ovo-like 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41264

Eigenschaften

Anwendung: IHC, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, cow, dog, horse)
Immunogen: Synthetic peptide around the N-terminal region of Human OVOL2. (within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG)
MW: 30 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-OVOL2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen