Anti-NR5A1

Anti-NR5A1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58758.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Transcriptional activator. Essential for sexual differentiation and formation... mehr
Produktinformationen "Anti-NR5A1"
Protein function: Transcriptional activator. Essential for sexual differentiation and formation of the primary steroidogenic tissues (PubMed:27378692). Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'- RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1 (PubMed:27378692). The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity. Binds phosphatidylcholine. Binds phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. [The UniProt Consortium]
Schlagworte: Anti-SF-1, Anti-NR5A1, Anti-STF-1, Anti-AD4BP, Anti-hSF-1, Anti-Steroidogenic factor 1, Anti-Adrenal 4-binding protein, Anti-Fushi tarazu factor homolog 1, Anti-Steroid hormone receptor Ad4BP, Anti-Nuclear receptor subfamily 5 group A member 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58758

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit, sheep)
Immunogen: Synthetic peptide around the middle region of Human NR5A1. (within the following sequence: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP)
MW: 52 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NR5A1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen