Anti-Neuroserpin

Aktion:

Sichern Sie sich 30% Rabatt auf alle Primärantikörper von Arigo Biolaboratories!

^*1

^*1 Angebot gültig bis zum 16.12.2024

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Rabatt	Preis
ARG59897.50	50 µg		-	-	6 - 14 Werktage*		30 %	520,00 € 364,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but... mehr

Menü schließen

Produktinformationen "Anti-Neuroserpin"

Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin (PubMed:9442076, PubMed:26329378, PubMed:19265707, PubMed:19285087, PubMed:11880376). May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable). [The UniProt Consortium]

Schlagworte:	Anti-PI12, Anti-PI-12, Anti-SERPINI1, Anti-Serpin I1, Anti-Neuroserpin, Anti-Peptidase inhibitor 12
Hersteller:	Arigo Biolaboratories
Hersteller-Nr:	ARG59897

Eigenschaften

Anwendung:	WB
Antikörper-Typ:	Polyclonal
Konjugat:	No
Wirt:	Rabbit
Spezies-Reaktivität:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 272-310 of Human Neuroserpin. (KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKAL)
MW:	46 kD
Format:	Antigen Affinity Purified