Anti-Neuroserpin

Anti-Neuroserpin
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59897.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but... mehr
Produktinformationen "Anti-Neuroserpin"
Protein function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin (PubMed:9442076, PubMed:26329378, PubMed:19265707, PubMed:19285087, PubMed:11880376). May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable). [The UniProt Consortium]
Schlagworte: Anti-PI12, Anti-PI-12, Anti-SERPINI1, Anti-Serpin I1, Anti-Neuroserpin, Anti-Peptidase inhibitor 12
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59897

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 272-310 of Human Neuroserpin. (KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKAL)
MW: 46 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Neuroserpin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen