Anti-MYCL (MYCL1, v-Myc Myelocytomatosis Viral Oncogene Homolog 1 Lung Carcinoma Derived (Avian), Cl

L-Myc is a nuclear protein with two molecular forms of 60 and 66kD and it plays a role in the control of cell growth, cell cycle progression, neoplasia, and apoptotic cell death. It contains a basic helix-loop-helix leucine zipper domain required for dimerization and binds DNA as an heterodimer with Max protein. Both molecular forms have been detected in some carcinoma cell lines. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.