Anti-MYBPC2

Anti-MYBPC2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40423.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Thick filament-associated protein located in the crossbridge region of... mehr
Produktinformationen "Anti-MYBPC2"
Protein function: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. [The UniProt Consortium]
Schlagworte: Anti-MYBPC2, Anti-MYBPCF, Anti-Fast MyBP-C, Anti-Myosin-binding protein C, fast-type, Anti-C-protein, skeletal muscle fast isoform
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40423

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse)
Immunogen: Synthetic peptide around the N-terminal region of Human MYBPC2. (within the following region: KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT)
MW: 128 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MYBPC2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen