Anti-Musashi 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41352.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: RNA binding protein that regulates the expression of target mRNAs at the... mehr
Produktinformationen "Anti-Musashi 1"
Protein function: RNA binding protein that regulates the expression of target mRNAs at the translation level. Regulates expression of the NOTCH1 antagonist NUMB. Binds RNA containing the sequence 5'- GUUAGUUAGUUAGUU-3' and other sequences containing the pattern 5'- [GA]U(1-3)AGU-3'. May play a role in the proliferation and maintenance of stem cells in the central nervous system. [The UniProt Consortium]
Schlagworte: Anti-MSI1, Anti-Musashi-1, Anti-RNA-binding protein Musashi homolog 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41352

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 21-54 of Human Musashi 1. (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD)
MW: 39 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Musashi 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen