Anti-MMP9

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32092 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metallopeptidase 9, or 92 kDa type... mehr
Produktinformationen "Anti-MMP9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metallopeptidase 9, or 92 kDa type IV collagenase, is part of a family of proteins involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP9 degrades type IV and V collagens. Protein function: Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. [The UniProt Consortium]
Schlagworte: Anti-Mmp9, Anti-GELB, Anti-Clg4b, Anti-MMP-9, EC=3.4.24.35, Anti-Gelatinase B, Anti-92 kDa gelatinase, Anti-92 kDa type IV collagenase, Anti-Matrix metalloproteinase-9, MMP9 Antibody
Hersteller-Nr: R32092

Eigenschaften

Anwendung: WB, IHC (paraffin), ELISA
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Mouse, Rat
Immunogen: Amino acids KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF of mouse MMP9 were used as the immunogen for the MMP9 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MMP9"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen