Anti-MMP9

Anti-MMP9
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31968 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metallopeptidase 9 (MMP-9), also... mehr
Produktinformationen "Anti-MMP9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. Protein function: May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-, -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. [The UniProt Consortium]
Schlagworte: Anti-MMP9, Anti-CLG4B, EC=3.4.24.35, MMP9 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31968

Eigenschaften

Anwendung: WB, ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY of human MMP9 were used as the immunogen for the MMP9 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MMP9"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen