Anti-MMP10

Anti-MMP10
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31922 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-2 also known as matrix... mehr
Produktinformationen "Anti-MMP10"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-2 also known as matrix metalloproteinase-10 or Transin-2 is an enzyme that in humans is encoded by the MMP10 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Protein function: Can degrade fibronectin, gelatins of type I, III, IV, and V, weakly collagens III, IV, and V. Activates procollagenase. [The UniProt Consortium]
Schlagworte: Anti-SL-2, Anti-MMP10, Anti-STMY2, Anti-MMP-10, Anti-Transin-2, EC=3.4.24.22, Anti-Stromelysin-2, Anti-Matrix metalloproteinase-10, MMP10 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31922

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids RFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAF of human MMP10 were used as the immunogen for the MMP10 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MMP10"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen