Anti-MGST1

Anti-MGST1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31937 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Microsomal glutathione S-transferase 1 is... mehr
Produktinformationen "Anti-MGST1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [The UniProt Consortium]
Schlagworte: Anti-MGST1, Anti-GST12, Anti-Microsomal GST-I, Anti-Microsomal GST-1, Anti-Microsomal glutathione S-transferase 1, MGST1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31937

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA of human MGST1
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MGST1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen