Anti-MAK

Anti-MAK
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59008.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Essential for the regulation of ciliary length and required for the long-term... mehr
Produktinformationen "Anti-MAK"
Protein function: Essential for the regulation of ciliary length and required for the long-term survival of photoreceptors. Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells. [The UniProt Consortium]
Schlagworte: Anti-MAK, Anti-Male germ cell-associated kinase, Anti-Serine/threonine-protein kinase MAK
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59008

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 588-623 of Human MAK (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR)
MW: 71 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MAK"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen