Anti-LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Anti

Anti-LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Anti
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
L7715-05Q.100 100 µg - -

9 - 20 Werktage*

943,00 €
 
Applications: |Suitable for use in Western Blot. Other applications have not been... mehr
Produktinformationen "Anti-LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Anti"
Applications: , Suitable for use in Western Blot. Other applications have not been tested. Recommended Dilutions: Western Blot: 1ug/ml, Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared antigen 1, Anti-Retinoic acid-induced gene E protein
Hersteller: United States Biological
Hersteller-Nr: L7715-05Q

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: LY6E (NP_002337.1, 1-131aa) full-length human protein.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-LY6E (Lymphocyte Antigen 6E, Ly-6E, Retinoic Acid-induced Gene E Protein, RIG-E, Stem Cell Anti"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen