Anti-LRIG3

Anti-LRIG3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32545 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LRIG3 (leucine-rich repeats and Ig-like... mehr
Produktinformationen "Anti-LRIG3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1. Protein function: May play a role in craniofacial and inner ear morphogenesis during embryonic development. May act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1. [The UniProt Consortium]
Schlagworte: Anti-LIG3, Anti-LRIG3, Anti-LIG-3, Anti-Leucine-rich repeats and immunoglobulin-like domains protein 3, LRIG3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32545

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids 428-465 (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-LRIG3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen